EVA results for 1jgk:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,.
seq	MKCKICNFDTCRAGELKVCASGEKYCFKESWREARGTRIERGCAATCPKGSVYGLYVLCCTTDDCN
dssp	-EEEE---------EEEE------EEEEEEE------EEE--EE-----------EEEEE------
apssp	-E--E-----------HH------EEEEEEE------EEE--EE----------EEEEEE------	+15.8	+18.3	+0.22
jpred	--EE--------------------EEEEEEE------EEEE-------------EEEEEE------	+10.9	+7.4	+0.05
phd	--EEE----------EEEEE----EE-HHHHHHH----EEE---------EEEEEEEEEE------	-1.8	+10.2	-0.09
phdpsi	-EEEEE------------------EEEEEEEE----EEEE---------------EEEEE------	+11.8	+9.1	+0.08
profsec	-EEEEE------------------EEEEEEEE----EEEE---------------EEEEE------	+9.5	+6.0	+0.03
sspro2	---EEEE----------------EEEEE--HHH-----EE-----------EEEEEEEEE------	-9.2	-6.3	-0.30

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)