EVA results for 1jju:C

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,....7....,....
seq	MNALVGCTTSFDPGWEVDAFGAVSNLCQPMEADLYGCADPCWXPAQVADTLNTYPNWSAGADDVMQDWRKLQSVFPETK
dssp	-----------------------------HHH-HHHHH-------------------------HHHHHHH---------
apssp	----E-----------EHH--------------------------------------------HHHHHHHH--------	+15.4	-10.7	-0.04
phd	------HHHH------HHHEEHHHH-----HHHHHH-------HHHHHHHHHH-------HHHHHHHHHHHHHH-----	-14.0	-31.2	-0.19
phdpsi	---------------EEE-----------------------------HHHH------------HHHHHHHHHH------	+3.3	-9.1	-0.18
profsec	---EEE---------EEE-----------------------------HHHH------------HHHHHHHHHH------	-2.8	-26.0	-0.24
samt99_sec	---EE-----------E------------------------------HHHH------------HHHHHHHH--------	+4.1	-22.3	-0.21
sspro2	---EE----------EEEHHHHHH-------H-----------HHHHHHHH---------HHHHHHHHHHHHHH-----	-18.0	-33.7	-0.36

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)