EVA results for 1luz:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,....7....,....8....,
seq	FCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKXHXDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRXCRHQ
dssp	----------EEEEEEEEE--EEEEEE------EEEEHHH----HHHHHHHHHHH---EEEEEEEEEE----EEEEEEEEE----
apssp	----------EEEEEEEEE---EEEEE------HHHHHHHH-----HHHHHHEEEE---EEEEEEEE-----EEEE-HH------	+0.9	+14.0	-0.00
apssp2	----------EEEEEEEEE--EEEEEE-------EEEEEHH-----HHHHHHHH----EEEEEEEEE-----EEE----------	+0.3	+9.9	0.00
prof_king	---------EEEEEEEEE----EEEEEE------EEEEEEEE----HEEEHH------EEEEEEEEE-----EEEEEEE------	+0.7	+2.8	-0.00
psipred	----------EEEEEEEEE--EEEEEE------EEEEEHHHHHHHHHHHHHHHH----EEEEEEEEE-----EEE----------	+6.8	+8.5	+0.17
samt99_sec	HHHH------EEEEEEEE----EEEEE-----EEEEEEEEEEE-HHHH--HH------EEEEEEEE------EEEEEHHHHH---	-4.9	+2.7	-0.10
sspro2	----------EEEEEEEE---EEEEE-----HHHHHHHHHHHHHHHHHHHHHHHH---EEEEEEEEEEEEEEEEEE-HHHHH---	-2.7	-3.1	+0.01

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)