EVA results for 1lub:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5
seq	MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKV
dssp	----EEE--EEE---HHH----------------HHHHHHHHHHHHHHH-
psipred	----------EEEE-----EEEEEEEEHHHHHHHHHHHHHHHEEEEEEE-	-39.9	-37.5	-0.33
apssp	-------------------EEEEEEEEEE---EEEEEEE--EEEEEEEE-	-48.3	-59.2	-0.25
apssp2	----------EEEE-----EEEEEEEEEE----HHHEHHHHHEEEEEEE-	-39.0	-49.0	-0.38
jpred	-----------EEEE-----EEEEEEEEE---EEEEEEE--EEEEEE---	-47.9	-51.8	-0.29
phd	-----------------EEEEEEEEEEEEEEEEEEEEEE---EEEEEEE-	-50.5	-59.6	-0.11
phdpsi	-----------------EEEEEEEEEEEEEEEEEEEEEE---EEEEEEE-	-54.2	-62.9	-0.17
prof_king	------------------EEEEEEEEEEE---EEEEEEE--EEEEEEEE-	-48.5	-55.6	-0.19
profsec	-------------------EEEEEEEEEE---EE-EEEE--EEEEEEEE-	-48.5	-60.4	-0.24
sspro2	----------EEEE-----EEEEEEEEEEE---EEEEEE--EEEEEEE--	-48.8	-54.2	-0.35
prospect_secstruc	-------------------EEEEEEEEEE---EEEEEE---EEEEEEEE-	-42.0	-53.1	-0.17
prospect	-------------------EEEEEEEEEE---EEEEEE---EEEEEEEE-	-43.7	-55.2	-0.19

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)