EVA results for 1lf7:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4..
seq	ASPISTIQPKANFDAQQFAGTWLLVAVGSAGRRAEATTLHVA
dssp	--HHHH--------HHHH-EEEEEEEEE--------EEEEEE
apssp	--------------HHHH--EHHHEEE----HHHHHHHE--E	-19.3	-30.8	-0.2
apssp2	--------------HHH---EEEEEEEE-----EEEEEEEEE	-4.5	+1.1	-0.02
phd	---------------HHHEEEEEEEEEE-----EEEEEEEEE	+8.0	+11.4	+0.29
phdpsi	-------------------EEEEEEEEEE-----EEEEEEEE	-0.4	-4.5	+0.25
prof_king	-------------------EEEEEEEEE----EEEEEEEEEE	-3.2	-8.8	+0.20
profsec	--------------HHH---EEEEEEEEE-----EEEEEEEE	+2.0	+7.1	+0.13
psipred	--------------HHHH-EEEEEEEEEE-----EEEEEEEH	+3.0	+6.9	+0.14
sspro2	--------------HHHHE-EEEEEEEE-------EEEEEEE	+6.3	+9.4	+0.18
jpred	--------------------EEEEEEE-------EEEEEEEE	-2.5	-2.2	+0.10
prospect_secstruc	---------------------EEHHHHH-------EEEEEEE	-8.1	-13.3	+0.14
prospect	---------------------EEHHHHH-------EEEEEEE	-9.8	-15.4	+0.12

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)