EVA results for 1kyr:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....
seq	GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQC
dssp	-HHHH--EEEEEEEEEEEE--EEEEEEEEEEEEHHH-EEEEEEEE--------HHHH-----HH
apssp	-------EEEEEEEEEEEE--EEEEEEEEEEEE----EEEEEEE----------HH------HH	+8.8	+12.5	+0.34
apssp2	---EE--EEEEEEEEEEEE--EEEEEEEEEEEE----EEEEEEEE--------HHHH-----HH	+6.5	+8	+0.21
jpred	----E--EEEEEEEE-------EEEEE------------EEEEEEE------------HHH-HH	-17.8	-10.6	-0.11
phd	--EEE---EEEEEEE--------EEE------------EEEEEEE-----------EEEEHHHH	-18.6	-11.9	-0.16
phdpsi	--HHHH--EEEEEEEEE-----EEEEEE--------EEEEEEEEE-------HHHHHHHHHHHH	-7.2	+2.5	+0.05
prof_king	--EEEE-EEEEEEEEE-----EEEEEEEE---------EEEEEEEE-----------HHHHHHE	-16.9	-3.5	-0.11
profsec	--HHHHHEEEEEEEEEEEE--EEEEEEEEE-------EEEEEEEEE------HHHHHHHHHHHH	-1.6	+2.8	+0.13
psipred	---EEEEEEEEEEEEEEEE---EEEEEEEE-------EEEEEEEEEE-------HHHHHHHHHH	-10.3	-4.2	-0.11
sspro2	--HH----EEEEEEEE-----EEEEEEE----------EEEEEEEE-------HHHHHHHHHHH	-10.0	+0.7	-0.02

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)