EVA results for 1koy:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6..
seq	SHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQT
dssp	-HHHHHH-----------HHHHHHHH---HHHHHHH----HHHHHHHHHHHHHHHHHHHH--
apssp	-HHHHHHHH-------------HHE-----HHHHHHHEHH---HHHHHHHHHHHHHHHHH--	-2.4	+11.3	-0.22
apssp2	--HHHHHHH----------HHHHHHH------EEEEEE----HHHHHHHHHHHHHHHHH---	-8.9	+5.1	-0.25
prof_king	---HH--H-----HHHH-HHHHHHH------HHHHHH--------HHHHHHHHHHHHHHH--	-3.5	+1.5	-0.21
prospect_secstruc	--HHHHHH-----------HHHHH-----HHHHHHHH-----HHHHHHHHHHHHHHHHH---	+13.4	+27.0	+0.08
psipred	-HHHHHHH----------HHHHHHH------EEEEEEE----HHHHHHHHHHHHHHHH----	-2.0	+9.5	-0.06
samt99_sec	HHHHHHHHH------------HHH-----HHHHHHHHH---HHHHHHHHHHHHHHHHHHHH-	+5.0	+15.9	-0.10
sspro2	-HHHHHHHH-----EE------EEE----HHHHHHHH-------HHHHHHHHHHHHHHHH--	-4.2	-1.4	-0.16
prospect	--HHHHHH-----------HHHHH-----HHHHHHHH-----HHHHHHHHHHHHHHHHH---	+13.7	+27.9	+0.09

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)