EVA results for 1kk1:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,.
seq	SRQAEVNIGMVGHVDHGKTTLTKALTGVWTDSEELR
dssp	---EEEEEEEE------HHHHHHHHH------HHHH
apssp	-----EEEEEEE-----HHHHHHHHHHHHHHHHHHH	-0.5	-4.4	+0.11
apssp2	----EEEEEEEEEE---HHHHHHHHHHHHHHHHHHH	-10.3	-16.5	-0.05
phd	------EEEEEEE----HHHHHHHHHHH--------	-0.8	+10.3	+0.05
phdpsi	------EEEEEEE----HHHHHHHHHHH--------	-5.0	+6.5	-0.00
prof_king	----EEEEEEEEEE-----HEEEEEEHHH--HHHH-	-21.9	-7.0	-0.17
profsec	-----EEEEEEEE----HHHHHHHHHHH--------	-4.4	+9.3	-0.00
psipred	----EEEEEEEE-----HHHHHHHHHHHHHHHHHHH	+0.2	-6.5	+0.14
sspro2	-----EEEEEEEE--------HHHHHHHHHHHHHH-	-18.9	-15.9	-0.11

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)