EVA results for 1kjy:B

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,
seq	DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFL
dssp	-HHHHHHHHH----HHHH-------HHHH------
apssp	-HHHHHHHHHHH------HHHHHHHHH--------	-19.5	-16.3	-0.38
apssp2	--HHHHHHHHHHH-----HHH--HHHH--------	-26.4	-16.0	-0.52
jpred	-HHHHHHHHHHHH-----HHHHHHHH---------	-22.6	-18.6	-0.34
phd	-HHHHHHHHHHHHH---HHHHH-------------	-13.5	-16.2	-0.25
phdpsi	-HHHHHHHHHHHHH---HHHHH-------------	-17.1	-19.5	-0.31
prof_king	-HHHHHHHHHHHH------------------H---	-8.9	-23.2	-0.26
profsec	-HHHHHHHHHHHH----HHHH-HHHH---------	-19.5	-14.5	-0.35
psipred	-HHHHHHHHHHHHH----HHH---HHH--------	-17.9	-10.7	-0.38
sspro2	-HHHHHHHHHHHH------HHHHHHHH-----H--	-22.6	-22.3	-0.37
prospect_secstruc	HHHHHHHHHHHHHH---HHHH--EE----------	-18.6	-14.4	-0.24
prospect	HHHHHHHHHHHHHH---HHHH--EE----------	-20.3	-16.5	-0.26

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)