EVA results for 1kj6:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,
seq	GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
dssp	---------HHHHH--EEE-------EEEEE-------EEEEE--
apssp	-----EHHHH-E-----EEEEE-----------------------	-23.6	-33.7	-0.31
apssp2	-HHHHHH-HEHHH----EEEEE----HHH-----HHHHHHHH---	-34.4	-30.0	-0.31
jpred	---------EE-----EEEEE-------E----------------	-10.0	-15.2	-0.25
phd	----------------EEEE--------EEEEE-------EEE--	+3.6	+8.6	+0.01
phdpsi	----------------EEEE--------EEEEE-------EEE--	-1.2	+4.2	-0.05
profsec	----------------EEEE--------EEEE------EEEEE--	+3.2	+6.7	+0.07
psipred	-HHHHHHHHHHEE---EEEEEEE----HH----HHHHHHHH----	-44.0	-40.0	-0.37
samt99_sec	--HHHH-----E----EEEEE------EEEEE-------E-----	-13.4	-11.2	-0.18
sspro2	-HHHHHHHHEHE-----EEEEE-----HH----------------	-35.3	-40.4	-0.35

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)