EVA results for 1jo8:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,...
seq	PWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSLGN
dssp	--EEE---E------E--E----EEEEEE-----EEEEEE-----EEEEEHHHEEE--
apssp	--E--------------------EEEEEE-----EEEEE--------EE----EE---	+2.8	-5.5	+0.05
jpred	-----------------------EEEEEE------EEEE------EEEE---EEEE--	+4.8	-7	+0.06
phd	-EEEEEEEE-------EEE----EEEEE-------EEE-------EEEE----EEEE-	+2.7	+6.5	-0.03
phdpsi	--EEEEEEE-------EEE----EEEEE-------EEE-------EEEE---EEEEE-	-0.4	+3.2	-0.12
prof_king	-EEEEEEE------EEEEE---EEEEEEE-----EEEEEEE-----EEE--EEEEEE-	-2.5	+2.2	-0.13
profsec	--EEEEEEE--------EE----EEEEEEE----EEEEEEE----EEEE---EEEE--	+4.2	+7.7	-0.00
psipred	-EEEEE-----------------EEEEEE-----EEEEEE-----EEEEE--EEEE--	+8.8	-3.5	+0.08
samt99_sec	-EEEEEE----------------EEEEEE-----EEEEEEE----E-E----HEEE--	+3.6	-9.6	-0.01
sspro2	--EEEEEE---------------EEEEEEE-----EEEEE-----EEEE-H-EEEE--	+3.4	+0.2	-0.03

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)