EVA results for 1fu9:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,.
seq	GSAAEVMKKYCSTCDISFNYVKTYLAHKQFYCKNKP
dssp	---------EE----EE---HHHHHHHHHH------
jpred	-------------E------HHHHHHHHH-------	+9.0	+3.6	+0.28
phd	--HHHHHHHH-----HHHHHHHHHHHHHHHHH----	-15.7	-6.3	-0.07
phdpsi	-------------------HHHHHHHHHHHHH----	+6.6	-2.1	+0.25
prof_king	--HHHHHHHH-------HHHHHHHHHHHHHH-----	-16.0	-6.7	-0.09
profsec	--HHHHHHHHHHH---EE--HHHHHHHHHHH-----	-15.2	-0.7	-0.12
psipred	--HHHHHHHHHHH---HHHHHHHHHHH--EEE----	-34.4	-16.1	-0.33
pssp	---HHHHHHH--EEEE-HHHHHHHH---EEEE----	-24.0	-3.6	-0.15
samt99_sec	---------EEEEEEEEE--HHHHHHHHHEE-----	+4.7	+10.9	+0.30
sspro1	----HHH---HHHH-----HHHHHHHHHHH------	-6.5	-9.9	-0.03

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)