EVA results for 1fma:D

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,....7....,....8.
seq	MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLVSFDHPLTDGDEVAFFPPVTGG
dssp	-EEEEE-HHHHHHH---EEEE-----EHHHHHHHHH---HHHHHH------EEEE--EE-----E-----EEEEE------
jpred	---HHHHHHHHHHH----EEEE----HHHHHHHHHHH----HHHHHH---EEEEE---------------EEEEE------	+3.2	+3.6	+0.07
phd	--EEE---HHHHHHH-HHHHHH----HHHHHHHHHH----HHHHHHHHHHHEEEE---E-----------EEEEE------	+3.4	+3.8	+0.14
phdpsi	--EEEEEEHHHHH------EE---HHHHHHHHHHHHHH-----EEE---EEEEEE---------------EEEEEE-----	-4.1	-3.1	-0.03
pssp	--EEEHHHHHHHH-----HHH--HH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-EEEEE-------EEEEE------	-3.1	-10.3	+0.04
samt99_sec	-EEEEEEHHHHHHH-----EEE-----HHHHHHHHHHHHHHHHHHHH--EEEEEE---------------EEEEE------	+5.0	-4.4	+0.19
sspro	--EEEEHHHHHHHH----HEEE---HHHHHHHHHHHHH-----HHH----EEEEEE-EE-----------EEEEE------	+2.8	+8.9	+0.07

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)