EVA results for 1fjf:N

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6
seq	ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW
dssp	--HHH--HHH-----HHH----------HHHE------EHHHHHHHHHH------EE---
jpred	-HHHHHHHHH-------E----EEE-------------HHHHHHHHHHH-----------	-0.9	-14.7	-0.07
phd	---HHHHHH----------------------HHH-----HHHHHHHHHH-----------	+1.9	-10.0	-0.05
phdpsi	--HHHHHHH--------EE----E---------------HHHHHHHHH------------	-0.6	-13.9	-0.01
prof_king	-HHHHHHHHH----------------------------HHHHHHHHHHH-----------	+3.9	-22.0	-0.03
profsec	--HHHHHHHH---------------------EEEE----HHHHHHHHHH-----------	+0.3	-15.0	-0.01
psipred	--HHHHHHH------HHHH-EEE-------EE-------HHHHHHHHHH-----------	+2.1	-10.2	-0.00
pssp	-HHH-HHHHH-----EEEEEHHHHEE-----------HHHHHHHHHH---------EE--	-4.6	+4.4	-0.09
sspro1	-HHHHHHHH-------EEEEEEEE------HHHHH--HHHHHHHHHHH-------EE---	-12.6	-5.0	-0.18

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)