EVA results for 1dl6:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,...
seq	ASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDK
dssp	-------------E--E-----EE------EE------EE------------------
jpred	------------E--------EEE------EE-----EEEE-E---------E-----	+12	-9.6	-0.07
phd	-----------EE------EEEEEE-----EEEE---EEEEEEE-------E------	+1.0	-3.0	-0.13
phdpsi	------------EE------EEEEE-----EEEE---EEE-EEEE-------------	+5.3	-0.9	-0.05
prof_king	---------------------EEEE----EEEEE---EEEEEEEEE------------	+1.5	+8.1	-0.19
profsec	-----------EE-------EEEEE-----EEE----EEEE-EEE------EE-----	-2.2	-18.7	-0.22
psipred	---------------------EEEE-----EEHHH--EEEE-EEEE------------	+1.4	-10.5	-0.17
pssp	--------------------EEE--------EE----EEEEEEEEEE---EEEE----	+4.2	-6.4	-0.14
samt99_sec	--------------------EEEE------EEE----EEE---EE-----HHH-----	+5.1	-18.1	-0.09
sspro1	---HHHH-------------EEEE------EEE----EEE---EE----HHH------	-1.8	-23.2	-0.12

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)