Home - sec - acc - cm - fr - con - Bottom

EVA results for 1fu9:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,.
seq	GSAAEVMKKYCSTCDISFNYVKTYLAHKQFYCKNKP
dssp	---------EE----EE---HHHHHHHHHH------
eva3	--HHHHHHHHHH-----HHHHHHHHHHHHHEE----	-25.2	-11.4	-0.18
eva4	----HHH---HHHH-----HHHHHHHHHHH------	-8.2	-13.0	-0.06
eva5	----HHH---HHHH-----HHHHHHHHHHHE-----	-11.6	-13.3	-0.15
eva6	----HHH---HHHH-----HHHHHHHHHHH------	-8.7	-12.3	-0.07
jpred	-------------E------HHHHHHHHH-------	+8.3	+3.0	+0.27
phd	--HHHHHHHH-----HHHHHHHHHHHHHHHHH----	-16.2	-7.2	-0.07
phdpsi	-------------------HHHHHHHHHHHHH----	+5.9	-3.8	+0.25
prof	----HHHHHHHH-----HHHHHHHHHHHHHHH----	-17.9	-2.3	-0.14
psipred	--HHHHHHHHHHH---HHHHHHHHHHH--EEE----	-35.3	-17.4	-0.34
pssp	---HHHHHHH--EEEE-HHHHHHHH---EEEE----	-25.3	-5.6	-0.18
samt99_sec	---------EEEEEEEEE--HHHHHHHHHEE-----	+3.9	+10.0	+0.28
sspro	----HHH---HHHH-----HHHHHHHHHHH------	-6.7	-10.5	-0.04

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)

Home - sec - acc - cm - fr - con - Top