Home - sec - acc - cm - fr - con - Bottom

EVA results for 1fs1:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4.
seq	WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLW
dssp	-----HHHHHHHH----HHHHHHHH---HHHHHHH--HHH-
eva3	-----HHHHHHHHHH--HHHHHHHHHHHHHHHHH-------	-0.0	-9.6	-0.17
eva4	-----HHHHHHHHHH--HHHHHHHHHHHHHHHHHH------	+2.8	-9.0	-0.12
eva5	-----HHHHHHHHHH--HHHHHHHHHHHHHHHHHH------	+2.1	-9.3	-0.19
eva6	-----HHHHHHHHHH--HHHHHHHHHHHHHHHHHH------	+2.3	-8.3	-0.13
jpred	-----HHHHHHHHHH-----HHHHHHHHHHHHHHH------	-1.7	-8.0	-0.19
phd	----HHHHHHHHHHH--HHHHHHHHHHHHHHHHHHH-----	+3.7	-5.4	-0.08
phdpsi	-----HHHHHHHHHH---HHHHHHHHHHHHHHHHH------	+3.3	-7.7	-0.08
prof	-----HHHHHHHHHH---HHHHHHHHHHHHHHHHH------	+1.7	-10.3	-0.14
psipred	-----HHHHHHHHHH--HHHHHHHHHHHHHHHHH-------	+0.9	-9.1	-0.16
pssp	------HH--HHHEE------EE----HHEEEE--------	-20.3	-21.7	-0.14
samt99_sec	HHH--HHHHHHHHHH--HHHHHHHHHHHHHHHHHH--HHHH	+1.3	-2.6	-0.01
sspro	-----HHHHHHHHHH--HHHHHHHHHHHHHHHHHH------	+4.3	-6.5	-0.10

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)

Home - sec - acc - cm - fr - con - Top