Home - sec - acc - cm - fr - con - Bottom

EVA results for 1fka:R

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5
seq	RNVEVLKRFLSETGKILPRRRTGLSGKEQRILAKTIKRARILGLLPFTEK
dssp	-----------------------------HHHHHHHHHHH----------
eva3	--HHHHHHHH----EEEEEE-----HHHHHHHHHHHHHHHHHH-------	-20.0	-40.3	-0.12
eva4	--HHHHHHHHH----E---------HHHHHHHHHHHHHHHHHHH------	-13.6	-36.1	-0.13
jpred	---HHHHHHH-----E--------HHHHHHHHHHHHHHHHHHH-------	-6.9	-30.2	-0.06
phd	--HHHHHHHHHH----E--------HHHHHHHHHHHHHHHHHHHEE----	-13.8	-34.2	-0.03
phdpsi	--HHHHHHHHHH----EE-------HHHHHHHHHHHHHHHHHHH------	-14.6	-35.6	-0.06
prof	--HHHHHHHHH----E--EEE----HHHHHHHHHHHHHHHHHH-------	-16.2	-45.1	-0.10
psipred	--HHHHHHH-----EEEE-------HHHHHHHHHHHHHHHHHH-------	-13.0	-36.1	-0.09
pssp	--HHH-HHHHHHH--HH----------HHHHHHHHHH--EEE--------	-2.2	-27.9	-0.10
sspro	--HHHHHHHHH----E---------HHHHHHHHHHHHHHHHHHH------	-12.1	-33.6	-0.11

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)

Home - sec - acc - cm - fr - con - Top