Home - sec - acc - cm - fr - con - Bottom

EVA results for 1fa8:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,....7....,....8....,....9....,....10...,....11...,....12...,.
seq	MRLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVDKYELGTAYGHIALSVDNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKIELIEE
dssp	--EEEEEEE---HHHHHHHHHH----EEEEEEEE----EEEEEEE--------EEEEEEE-----------EEEEEEE---HHHHHHHHH----EEEEEEEE------EEEEEE-----EEEEE--
phd	-EEEEEEEEE---HHHHHHHHHHH--EEEEE-----EEEEEEEEEE-----EEEEEEEE-----------EEEEEEEE---HHHHHHHHHH----EEEEE------EEEEEEEE----EEEEEEE-	+9.3	+23.7	+0.20
psipred	--EEEEEEE---HHHHHHHHHHH---EEEEEE------EEEEEEE-------EEEEE----------------EEEEEHHHHHHHHHHHHH----------------EEEEEEE-----EEEEEE-	+3.5	+9.3	+0.13
sspro	--EEEEEEEE--HHHHHHHHHHHH--EEEE--------EEEEEE--------EEEEEE--------------EEEEEE---HHHHHHHHHH----EEE---------EEEEEEE-----EEEEEE-	+6.7	+18.9	+0.19

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)

Home - sec - acc - cm - fr - con - Top