Home - sec - acc - cm - fr - con - Bottom

EVA results for 1f6u:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,
seq	MQKGNFRNQRKTVKCFNCGKEGHIAKNCRAPRKKGCWKCGKEGHQMKDCTERQAN
dssp	--HHHHHHHHH--E------E---HHH-------EE----EE---HHH-------
jpred	-----------EEEEE---------------------------------------	-18.5	-57.3	-0.27
phd	-------------EE----------------------------------------	-10.0	-54.5	-0.15
phdpsi	-------------EEE---------------------------------------	-14.6	-57.2	-0.21
pssp	----------EEEEEE--------------------EE-------HHHHH-HHHH	-16.9	-34.4	-0.16
samt99_sec	-------------EEEE--------------------------------------	-18.4	-58.7	-0.28
sspro	----------EEEEE-------HHH-------------------------HHH--	-25.2	-43.7	-0.32

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)

Home - sec - acc - cm - fr - con - Top