Home - sec - acc - cm - fr - con - Bottom

EVA results for 1f43:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6.
seq	KKEKSPKGKSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK
dssp	--------------HHHHHHHHHHHH-----HHHHHHHHHHH-----HHHHHHHH------
eva3	-------------HHHHHHHHHHHHH-----HHHHHHHHHHH---HHHEEEEEE-------	+5.5	+14.4	+0.20
eva4	-------------HHHHHHHHHHHHHH----HHHHHHHHHHH---HHHEEEEHHHHHH---	+4.3	+7.6	+0.15
jpred	------------HHHHHHHHHHHHHHHH----HHHHHHHHHH---HHHHHHHHHHHH----	+10.2	+27.6	+0.11
phd	-------------HHHHHHHHHHHHH-----HHHHHHHHHHH---HHHHHHHHHH------	+23.2	+30.5	+0.51
phdpsi	-------------HHHHHHHHHHHHHH-----HHHHHHHHHH------EEEEE--E----	+5.3	+16.5	+0.13
prof	-------------HHHHHHHHHHHHHH-----HHHHHHHHHH-----EEEEEEE--EE--	+2.0	+6.7	+0.11
psipred	-------------HHHHHHHHHHHHH-----HHHHHHHHHHH---HHHEEEEEE-------	+6.5	+14.9	+0.21
pssp	--------------HHHHHHHHHHHH--------HHHHHH--------EEEHHHHHHHH--	+14.4	+26.0	+0.13
sspro	-------------HHHHHHHHHHHHHH----HHHHHHHHHHH---HHHHHHHHHHHHH---	+12.3	+23.1	+0.22

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)

Home - sec - acc - cm - fr - con - Top