Home - sec - acc - cm - fr - con - Bottom

EVA results for 1ef4:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,
seq	MIPVRCLSCGKPVSAYFNEYQRRVADGEDPKDVLDDLGLKRYCCRRMLISHVETW
dssp	-------------HHHHHHHHHHHHH---HHHHHHHH----HHHHHHH-------
eva3	---EEEE----HHHHHHHHHHHHHH----HHHHHHH----HHHHHHHH-EE----	+1.9	-4.1	+0.11
eva4	---EEEE----HHHHHHHHHHHHHH----HHHHHHH----EE-H-EEEEE-----	-8.5	-5.8	-0.08
jpred	----EEE---------HHHHHHHHH-----HHHHHH----HHHHHHHHEE-----	+3.2	+12.3	+0.11
phd	---EEEE-----HHHHHHHHHHHHH-----HHHHHH-----HHHHHHHHHHE---	+6.3	+4.7	+0.15
phdpsi	---EEEE-----HHHHHHHHHHHHH-----HHHHHH-----HHHHHHHHHEE---	+3.5	+2.4	+0.16
prof	----EEE----HHHHHHHHHHHHHHH----HHHHHH-----HHHHHHEEEE----	+3.7	+5.1	+0.13
psipred	---EEE-----HHHHHHHHHHHHH-----HHHHHHHH--HHHHHHHHH-------	+6.5	+2.6	+0.09
sspro	---EEEE----HHHHHHHHHHHHHH----HHHHHHH----EE---EEEEE-----	-8.8	-4.7	-0.09

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)

Home - sec - acc - cm - fr - con - Top