Home - sec - acc - cm - fr - con - Bottom

EVA results for 1e0f:I

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,..
seq	IRFGMGKVPCPDGEVGYTCDCGEKICLYGQSCNDGQCSGDPKPSSEFEEFEIDEEEK
dssp	-EE-----E---------EE----EE-----E----E--------------------
eva3	-----------------E-----EEE---------------------EEE-------	+0.8	-22.5	-0.36
eva4	-----------------------------------------------EEEEE-----	-2.2	-48.7	-0.33
eva5	------------------------E----------------------EEEEE-----	-1.1	-34.0	+8.39
phd	-EEE---E----------------E----------EEE--------EEEEE------	+3.5	-11.4	-0.20
phdpsi	-EEE---E----------------E----------EEE--------EEEEE------	+0.7	-13.7	-0.24
prof	-----------------------EE----------EEEE-------EEEEEE-----	-6.0	-31.9	-0.35
psipred	----------------EEE----EEEEE-----------------------------	+3.6	-10.5	-0.31
pssp	----EEEEEE---EEEEE----EEEEEEE------------------EEE---HH--	-9.8	-26.3	-0.18
samt99_sec	----------------EE-----EEEEE------------------HHHH-------	-4.7	-23.0	-0.31
sspro	-----------------------------------------------EEEEE-----	-0.7	-46.2	-0.31

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)

Home - sec - acc - cm - fr - con - Top