Home - sec - acc - cm - fr - con - Bottom

EVA results for 1dsx:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,....7....,....8....,..
seq	ERVVINISGLRFEVQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELG
dssp	-EEEEEE--EEEEEEHHHHH---------HHHHH--EE----EEEE------HHHHHHHHH------------HHHHHHHHHHH---
jpred	--EEEE---EEEEEHHHHHH----------------------EEEE-----HHHHHHHHHH------------HHHHHHHHHHH---	+12.5	+12.1	+0.27
phd	-EEEEE-----HHHHHHHHHH--HHH----------------EEE----HHHHHHHHHHHH---EEE-------HHHHHHHHH----	-3.3	-10.9	-0.05
psipred	-EEEEEE--EEEEEEHHHHHH--------HHHH---------EEEEE-----HHHHHHHHH---EEEE-----HHHHHHHHHHH---	+11.5	+7.3	+0.27
sspro	-EEEEEE---EE-HHHHHHHH--------HHHHHHH-------EEE----HHHHHHHHHH--------------HHHHHHHHHH---	+6.5	+17.6	+0.15

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)

Home - sec - acc - cm - fr - con - Top