Home - sec - acc - cm - fr - con - Bottom

EVA results for 1dpu:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,....
seq	ANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
dssp	-----HHHHHHHHHHHH------EEHHHHHHH-----HHHHHHHHHHHHH---EEE-----EEEE----
eva3	-----HHHHHHHHHHHH--------HHHHHHHHH---HHHHHHHHHHHH---EEEE-------------	+7.4	+8.8	+0.22
eva4	-----HHHHHHHHHHHH--------HHHHHHHHHH--HHHHHHHHHHHH----EEEE-------E----	+7.8	+14.5	+0.20
phd	-----HHHHHHHHHHHH--------HHHHHHHHH---HHHHHHHHHHHH---EEEE-------------	+13.6	+14.4	+0.35
phdpsi	-----HHHHHHHHHHHH--------HHHHHHHHH---HHHHHHHHHHHH---EEEE-------------	+10.8	+12.1	+0.31
prof	-----HHHHHHHHHHHH--------HHHHHHHHH----HHHHHHHHHHH---EEEEEE-----EE----	+7.8	+17.0	+0.19
psipred	-----HHHHHHHHHHHH--------HHHHHHHH----HHHHHHHHHHHHH---EE--------------	+11.3	+11.4	+0.38
pssp	----EEHHHHHHHHHH----------HHHHHHHH-----HHHHHHHHH----EEEEEE-----------	+8.2	+18.7	+0.13
sspro	-----HHHHHHHHHHHH--------HHHHHHHHHH--HHHHHHHHHHH-----EEEE-------E----	+7.9	+16.2	+0.17

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)

Home - sec - acc - cm - fr - con - Top