Home - sec - acc - cm - fr - con - Bottom

EVA results for 1dp5:B

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3.
seq	NTDQQKVSEIFQSSKEKLQGDAKVVSDAFMM
dssp	-HHHHHHHHHHHHHHHHHHHHHHHHHHHH--
eva3	---HHHHHHHHHHHHHHH----HHHHH----	-3.8	-21.1	-0.12
phd	---HHHHHHHHHHHHHHH------EEEE---	-13.7	+10.6	-0.04
phdpsi	---HHHHHHHHHHHHHH------EEEE---	-21.3	+2.0	-0.12
prof	---HHHHHHHHHHHHHHH-----EE-----	-19.5	+2.3	-0.19
psipred	---HHHHHHHHHHHHHHHH--HHHHHHH---	+6.8	-11.3	-0.01

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)

Home - sec - acc - cm - fr - con - Top