Home - sec - acc - cm - fr - con - Bottom

EVA results for 1d8k:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,....7....,....8.
seq	ALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVR
dssp	-HHHH----HHHHHHHHHHHHHHHHH-----E-HHHHHHHH------HHHHHHHHH-HHHH---EEEE--EEEE-------
eva3	--------HHHHHHHHHHHHHHH---------HHHHHHHHHHHH--HHHHHHHHHHHH-----EEEEE---EEE-------	-2.7	+3.4	-0.01
phd	-------HHHHHHHHHHHHHHHHHH---HHHHHHHHHH-----HHH-HHHHHHHHHHHHH----EEEEEEEE---------	-1.4	-3.8	+0.01
phdpsi	-------HHHHHHHHHHHHHHHHH---------HHHHHHHHHH----HHHHHHHHHHHH----EEEE----E-E------	+2.8	+4.0	+0.09
prof	-------HHHHHHHHHHHHHHHH---------HHHHHHHHHHH-----HHHHHHHHHHHH----EEEEE--EEE------	+1.2	+7.4	+0.04
psipred	--------HHHHHHHHHHHHHHH--------HHHHHHHHHHHHHHHHHHHHHHHHHHH-----EEEEE---EE--------	-5.4	-11.9	-0.08

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)

Home - sec - acc - cm - fr - con - Top