Home - sec - acc - cm - fr - con - Bottom

EVA results for 1by6:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,.
seq	AVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
dssp	--------------------------HHH--HHH--
eva3	---HHHHHHH----HHHHHHHHHHHHHHHHHH----	-41.9	-53.3	-0.38
eva4	---HHHHHHH----HHHHHHHHHHHHHHHHHH----	-41.5	-53.3	-0.38
eva5	---HHHHHHH----HHHHHHHHHHHHHHHHHH----	-42.2	-53.6	-0.45
eva6	---HHHHHHH----HHHHHHHHHHHHHHHHHH----	-42.0	-52.6	-0.39
jpred	---HHHHHH------EEHHH--HHHHHHHHHH----	-27.7	-47.5	-0.31
phd	-----HHHHH---HHHHHHHHHHHHHHHHHHH----	-32.9	-46.2	-8.02
phdpsi	-----HHHHH---HHHHHHHHHHHHHHHHHHH----	-35.7	-48.5	-8.06
prof	---HHHHHHH---HHHHHHHHHHHHHHHHHHH----	-42.9	-55.9	-0.34
psipred	---HHHHHHHH------HHHHHHHHHHHHHHH----	-35.3	-47.7	-0.37
pssp	--HHHHHHHHHHHHHHH-EEEEEE-HHHHHH-----	-39.2	-50.0	-0.11
samt99_sec	---HHHHHHHHH-HHHHHHHHHHHHHHHHHHHH---	-46.0	-58.5	-0.34
sspro	---HHHHHHH----HHHHHHHHHHHHHHHHHH----	-40.0	-50.8	-0.36

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : abbreviation of prediction method (seq=sequence)
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)

Home - sec - acc - cm - fr - con - Top