EVA results for 1rk8:C

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3...
seq	TYLQSSEGKFIPATKRPDGTWRKARRVKDGYVP
dssp	--EEE--EEEE--EE-----EE--EE-------
apssp2	---E-----E----------EHH-E--------	-5.2	-13.1	-0.15
prof_king	-----------------------H---------	-14.8	-39.8	-0.24
prospect	---------EE---------EEEEEE-------	+1.2	-13.7	-0.17
psipred	---------------------------------	-15.3	-61.2	-0.37
sable	--------EEE------------EEEE------	-6.0	-21.7	-0.26
sable2	--------EEE-------------EEE------	-4.2	-18.3	-0.25
samt99_sec	EEEE----EEE----------HH-EE-------	-2.7	-6.6	-0.17
scratch	-EEE-----EE---------HHHHHE-------	-8.8	-11.4	-0.19
sspro4	-EEE-----EE--------------E-------	-5.3	-16.6	-0.25
yaspin	--------EEEE------------EEEE-----	+0.1	-13.5	-0.31

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)