EVA results for 1pv0:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,.
seq	MRKLSDELLIESYFKATEMNLNRDFIELIENEIKRRSLGHIISVSS
dssp	-----HHHHHHHHHHHHHH---HHHHHHHHHHHHH-----------
apssp2	---HHHHHHHHHH--EHHH---HHHHHHHHHHHHHHH---EEEE--	+1.1	-11.9	-0.03
prof_king	-H---HHHHHHHHHHHHH----HHHHHHHHHHHHH------EE---	+18.8	+8.8	+0.36
prospect	-----HHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHH----	+8.9	+17.0	-0.02
psipred	----HHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHH-EEE---	+4.4	-2.8	+0.04
sable	-----HHHHHHHHHHHHHH---HHHHHHHHHHHHHHH---EEEEE-	+9	-5.2	+0.31
sable2	-----HHHHHHHHHHHHH----HHHHHHHHHHHHHH-----EEEE-	+10.0	+2.1	+0.23
samt99_sec	-----HHHHHHHHHHHHHH---HHHHHHHHHHHHHHHH---H----	+15.8	+7.4	+0.29
scratch	-----HHHHHHHHHHHHHH---HHHHHHHHHHHHHH----EEEE--	+13.5	+5.1	+0.40
sspro4	-----HHHHHHHHHHHHHH---HHHHHHHHHHHHHHH---EEEE--	+8.9	+0.1	+0.26
yaspin	-------EEEEEEEEEEEE---HHHHHHHHHHHHHHH---EEEE-	-10.9	-19.9	-0.11

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)