EVA results for 1nei:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6
seq	MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW
dssp	-----EEEEEEE-----EEEEE----HHH--HHHHHHHHHHHHHHHHH------------
apssp2	---EEEEEEEEE----EEEEEE----EEEE-HHHHHHHHHHHHHHHHH------------	+13.3	+20.0	+0.34
prof_king	---EEEEEEEEEEEEEEEEEE-----EEEE-HHHHHHHHHHHHH-H--------------	+2.5	-10.7	+0.12
prospect	----EEEEEEE-----EEEEEE-----EEE--HHHHHHHHHHHHHH--------------	+11.8	+25.9	+0.22
psipred	----EEEEEEE------EEEE-----EEEE--HHHHHHHHHHHHHHH-------------	+9.0	+20.8	+0.19
sable	---EEEEEEEE-----EEEEEE----EEEE-HHHHHHHHHHHHHHH----------E---	+5.9	+5.3	+0.16
sable2	---EEEEEEEE-----EEEEE------EEE-HHHHHHHHHHHHHHHH---------E---	+4.7	+7.4	+0.09
samt99_sec	----EEEEEEE-----EEEE-------EEE-HHHHHHHHHHHHHHHH-------------	+7.8	+19.5	+0.18
scratch	---EEEEEEEE-----EEEE-------HH--HHHHHHHHHHHHHHH--------------	+9.4	+23.9	+0.22
sspro4	---EEEEEEEE-----EEEE------HHH--HHHHHHHHHHHHHHH--------------	+8.6	+23.3	+0.20
yaspin	---EEEEEEEEE---EEEEE------EEEE-HHHHHHHHHHHHHHHHH-----------	+16.5	+20.2	+0.22

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)