EVA results for 1rkl:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,.
seq	MISDEQLNSLAITFGIVMMTLIVIYHAVDSTMSPKN
dssp	-----HHHHHHHHHHHHHHHHHHHHHHH--------
apssp2	---HHHHHHHHHHHHHHHHHHHHHHHHH--------	+19.4	+25.5	+0.36
phd	----HHHHHHHHHHHHHHHHEEEEEEE---------	+3.5	+29.6	+0.26
phdpsi	----HHHHHHHHHHHHHHHHEEEEEEE---------	+2.2	+28.5	+0.24
prof_king	---HHHHHHHHHHHHHHHHHHHHHHHH---------	+19.2	+28.6	+0.25
profsec	---HHHHHHHHHHHHHHHHHEEEHHHH---------	+8.3	-5.7	+0.14
psipred	----HHHHHHHHHHHHHHHHHHHHHHHHH-------	+18.5	+26.9	+0.35
sable	----HHHHHHHHHHHHHHHHHHHHHHHH--------	+21.4	+24.4	+0.47
sable2	----HHHHHHHHHHHHHHHHHHHHHHHHHH------	+15.5	+27.9	+0.22
samt99_sec	---HHHHHHHHHHHHHHHHHHHHHHHHHH-------	+16.3	+25.9	+0.28
scratch	---HHHHHHHHHHHHHHHHHHHHHHHHH--------	+18.9	+25.3	+0.37
sspro4	---HHHHHHHHHHHHHHHHHHHHHHHHHH-------	+14.7	+26.2	+0.24
yaspin	---HHHH--EEEEEEEEEEEEEEEEEE--------	-30.8	-24.5	+0.11

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)