EVA results for 1rqt:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,..
seq	SITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAA
dssp	---HHHHHHHH----HHHHHHHHHHHHHH--------
apssp2	---HHHHHHHHHHHHHHHHHHHHHHHHHHH-------	+11.6	-2.7	+0.17
jufo	---HHHHHHHHHHHHHHHHHHHHHHHHHHH-------	+17.5	+2.8	+0.21
phd	---HHHHHHHHHHHHHHHHHHHHHHHHHH----E---	+15.0	-5.3	+0.24
phdpsi	---HHHHHHHHHHHHHHHHHHHHHHHHHH----E---	+13.7	-6.5	+0.22
prof_king	---HHHHHHHHHH-HHHHHHHHHHHHHHH---HHH--	+11.3	+4.8	+0.15
profsec	---HHHHHHHHHHHHHHHHHHHHHHHHHH--------	+14.2	-1.7	+0.23
prospect	---HHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHH	+1.5	+6.0	-0.03
psipred	---HHHHHHHHHHHHHHHHHHHHHHHHHHH-------	+10.6	-4.0	+0.15
sable	---HHHHHHHHHHHHHHHHHHHHHHHHHH--------	+13.5	-5.0	+0.23
sable2	---HHHHHHHHHHHHHHHHHHHHHHHHHHH-H-----	+5.5	-18.2	+0.04
samt99_sec	---HHHHHHHHHHHHHHHHHHHHHHHHHHH-------	+11.1	-2.2	+0.17
scratch	---HHHHHHHHHHHHHHHHHHHHHHHHHH----H---	+10.9	-9.7	+0.17
sspro4	---HHHHHHHHHHHHHHHHHHHHHHHHHH----H---	+4.2	-5.4	+0.18

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)