EVA results for 1s5l:T

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3.
seq	METITYVFIFACIIALFFFAIFFREPPRITK
dssp	---HHHHHHHHHHHHHHHHHHH---------
apssp2	---EEEHHHHHHHHHHHHHHHHH--------	+12.2	+28.4	+0.35
jufo	---EEEEEHHHHHHHHHHHHHH---------	+15.0	+34.1	+0.51
phd	---HHHHHHHHHHHHHHHHHHHH--------	+25.4	+32.4	+0.51
phdpsi	---HHHHHHHHHHHHHHHHHHHH--------	+24.0	+31.2	+0.49
profsec	---HHHHHHHHHHHHHHHHHHH---------	+25.0	+27.9	+0.65
prospect	-------HHHH---HHHH-------------	-6.9	-22.5	-0.06
psipred	--HHHHHHHHHHHHHHHHHHHHH--------	+17.7	+27.1	+0.33
sable	--EEEHHHHHHHHHHHHHHHHHH--------	+11.5	+24.5	+0.27
sable2	--EEEHHHHHHHHHHHHHHHHHH--------	+9.2	+23.9	+0.21
samt99_sec	-HHHHHHHHHHHHHHHHHHHHHE--------	+15.0	+22.4	+0.29
scratch	--HHHHHHHHHHHHHHHHHHHHH--------	+18.0	+28.0	+0.35

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)