EVA results for 1s5l:L

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,..
seq	MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN
dssp	-------------HHHHHHHHHHHHHHHHHHHHHHH-
apssp2	--------------HHHHHHHHHHHHHHHHHHHH---	+17.0	+26.6	+0.31
jufo	--------------HHHHHHHHHHHHHHHHHHH----	+20.3	+32.1	+0.28
phd	--------HHHH-HHHHHHHHHHHHHHHHHHHHEE--	+9.6	+5.4	+0.08
phdpsi	--------HHHH-HHHHHHHHHHHHHHHHHHHHEE--	+8.3	+4.2	+0.06
prof_king	---------EEE-----HHHHHHHHHHHH--EEEE--	-10.1	-2.3	-0.05
profsec	---------EEE---HHHHHHHHHHHHHHHHHHH---	+6.1	+4.0	+0.20
prospect	----------EE--HHHHHHHHHHHHHHHHHHH----	+12.3	+8.2	+0.25
psipred	-------------HHHHHHHHHHHHHHHHHHHHH---	+18.8	+25.3	+0.37
sable	----------E--HHHHHHHHHHHHHHHHHHHHHH--	+19.0	+3.5	+0.44
sable2	---------EE--HHHHHHHHHHHHHHHHHHHHH---	+11.3	+2.6	+0.27
samt99_sec	----------HH-HHHHHHHHHHHHHHHHHHHHHE--	+13.9	+3.9	+0.19
scratch	---------EEE-HHHHHHHHHHHHHHHHHHHHHH--	+13.7	+3.0	+0.40

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)