EVA results for 1s5l:J

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,...
seq	SEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL
dssp	----------HHHHHHHHHHHHHHHHHHHHHH-HHH--
apssp2	----EEEEEEEEE----EEEEEHHHHHHHHH-------	-32.7	-18.9	-0.20
jufo	----EEEEEEEEEHHHHEEEEEEEEEE-----------	-39.9	-32.5	-0.23
phd	-----EEEEEEHHHHE-EHHHEEEEEEEEEEEEE----	-34.6	-36.7	-0.10
phdpsi	-----EEEEEEHHHHE-EHHHEEEEEEEEEEEEE----	-35.9	-37.9	-0.12
prof_king	-----EEEEEEE-----HEEEEEEEEEE----------	-48.6	-45.5	-0.28
profsec	-------EEHHHHHHHHHHHHHHHHEEEE---------	-9.1	+14.2	-0.14
prospect	-------EEEEEEE--EEEEEEEEEEEE----------	-45.1	-39.7	-0.19
psipred	------HHHHHHHHHHHHHHHHHHHHHHHHHHH-----	+3.1	+11.8	-0.15
sable	-----EEEEEEEEHHHHHHHHHHHHEEE----------	-22.9	-7.8	-0.14
sable2	-----EEEHHHHHHHHHHHHHHHHHHHHHHHH------	+1.0	+3.3	-0.01
samt99_sec	-------EEEEHHHHHHHHHHHHHHHHH--H-------	-1.5	-14.3	+0.04
scratch	-------EEHHHHHH---EEEEEEEEEHHHH-------	-25.4	-30.8	-0.20

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)