EVA results for 1s5l:I

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,...
seq	METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKDLE
dssp	-HHHHHHHHHHHHHHHHHHHHHH---------------
apssp2	--EEEEHHHHHHHHHHHHHHHHHH--------------	+9.3	+27.1	+0.25
jufo	---EEEEEEEEEEEEEHHHHH-----------------	-13.5	-7.0	+0.21
phd	-EEEEEEEEEEEEEEEEEEEEEEEE-------------	-34.6	-25.4	+0.44
phdpsi	-EEEEEEEEEEEEEEEEEEEEEEEE-------------	-35.9	-26.6	+0.42
prof_king	--EEEEEEEEEEHHHHEEEE------------------	-19.7	-11.8	+0.21
profsec	--EEEEEEEEEHHHHHHHHHHH----------------	-3.8	+10.8	+0.27
prospect	--EEEEEEEEEEEEEEEEEEEEE---------------	-29.3	-27.1	+0.53
psipred	--EEHHHHHHHHHHHHHHHHHHH---------------	+16.3	+25.8	+0.39
sable	-EEEEHHHHHHHHHHHHHHHHHH---------------	+13.9	+24.5	+0.50
sable2	-EEEEHHHHHHHHHHHHHHHHHHH--------------	+8.9	+23.9	+0.31
samt99_sec	--EEEEHHHHHHHHHHHHHEEEE---------------	+1.0	+19.7	+0.35
scratch	--HHHHHHHHHHHHHHHHHHHH----------------	+19.2	+26.7	+0.40

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)