EVA results for 1m36:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3...
seq	GSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWF
dssp	-------EE------EE--HHHHHHHHHH----
apssp2	-----EEEEHHHHHHHHHHHHHHHHHHHH----	-11.2	-10.6	-0.04
jufo	-----HHHHHHHHHHHHHHHHHHHHHH------	-17.3	-15.3	-0.18
phdpsi	-------EE-HHHHHHHHHHHHHHHHHHHH---	-3.0	-3.6	+0.1
prof_king	------HHHHHHHHHH---HHHHHHHHHH----	-5.8	+1.3	-0.02
profsec	-----HHHHHHHHHHHH-HHHHHHHHHHH----	-14.2	-5.0	-0.06
psipred	-----HHHHHHHHHHHHHHHHHHHHHHHH----	-17.9	-19.9	-0.11
sable	-----EEEEHHHHHHHH--HHHHHHHH---EEE	-21.1	-8.2	-0.14
samt99_sec	-----EEEEE-HHHHHH-HHHHHHHHHHH----	-5.5	+2.2	+0.02
scratch	-----HEEEHHHHHHHHHHHHHHHHHHHH----	-11.5	-9.1	-0.03
yaspin	-----EEEE-HHHHHH---HHHHHHHHHH---	+1.2	+6.9	+0.03

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)