EVA results for 1rji:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3.
seq	TPYPVNCKTDRDCVMCGLGISCKNGYCQGCT
dssp	-----E---HHHH--------E---EE----
apssp2	------------EEEE----------E----	-7.2	-20.7	-0.33
jufo	-------------EE----EE----------	-8.1	-23.5	-0.23
phd	-----------EEEEE-EEEEE----EEE--	-19.6	-27.1	-0.28
phdpsi	-----------EEEEE-EEEEE----EEE--	-21.1	-28.5	-0.30
prof_king	------------EEEEEEEEE----------	-24.3	-44.5	-0.23
profsec	------------EEE---EEE----------	-16.8	-34.4	-0.29
prospect	-------------EE----------------	-4.0	-34.8	-0.25
psipred	------------EEEE---------------	-11.0	-39.0	-0.32
sable	------------EEEE---------------	-12.9	-42.7	-0.29
samt99_sec	-------------EE----EEE---------	-10.6	-25.6	-0.30
scratch	-------------EEE---EE----------	-17.4	-35.6	-0.25

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)