EVA results for 1q90:N

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3.
seq	GEPAIVQIGWAATCVMFSFSLSLVVWGRSGL
dssp	---HHHHHHHHHHHHHHHHHHHHHHHHH---
apssp2	----EEEEE--EEEEEEEE-EEEEEE-----	-55.5	-53.8	+0.04
jufo	--EEEEEE--HHHHHHHH---EEEHH-----	-21	-29.7	-0.13
phd	---EHHHHHHHHHHHHHEEEEEEEEEEE---	-9.9	+13.2	+0.44
phdpsi	---EHHHHHHHHHHHHHEEEEEEEEEEE---	-11.4	+11.8	+0.42
prof_king	---EEEEE--EEEEEEEEEEEEEEEEE----	-53.3	-49.3	+0.25
profsec	--HHHHHHHHHHHHHHEEEEEEEEEE-----	-16.8	+7.8	0.00
prospect	HHHHHHHHHHHHHHH----------------	-23.3	-11.0	-0.31
psipred	----EEEE-HHHHHHHHHHEEEEEEEE----	-23.9	-4.6	+0.08
sable	---EEHHHHHHHHHHHEE---EEEEE-----	-22.6	-7.0	+0.02
samt99_sec	----EEEHHHHHHHHHHHEEEEEEEE-----	-20.3	-1.6	+0.10
scratch	---EEEEEEEHHEEHEEEEEEEEEEE-----	-46.5	-55.0	+0.20

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)