EVA results for 1pc0:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6.
seq	GLMVEVVESPNHSEVGIKGEVVDETQNTLKIMTEKGLKVVAKRGRTFRVWYKGKIMRIKGD
dssp	--EEEEEE------EEEEEEEE------EEEE----EEEE-----EEEEE----EEEEE--
apssp2	--EEEEE-----HHH----EEEEE---EEEEE-----EEE-----EEEEEE--EEEEE---	+0.4	+15.8	-0.11
jufo	--EEEEEE-----------EEEE----EEEEEE---EEEEE---EEEEEE---EEEEEE--	+12.6	+24.5	-0.00
phd	--EEEEEE-----EEEEEEEEEE----EEEEEE---EEEEE----EEEEEE--EEEEEE--	+17.2	+31.0	+0.29
phdpsi	--EEEEEE-----EEEEEEEEEE----EEEEEE---EEEEE----EEEEEE--EEEEEE--	+15.7	+29.6	+0.27
prof_king	--EEEEEE-----EEEEEEEEEE----EEEEEE---EEEEEE--EEEEEEE---EEEEE--	+14.1	+28	+0.23
profsec	--EEEEEE-----EEEEEEEEE-----EEEEEE---EEEEE---EEEEEEE--EEEEEE--	+13.5	+25.0	+0.23
prospect	--EEEEEE-----EEEEEEEEEEEE--EEEEEE---EEE-----EEEEEEE---EEEEE--	+13.4	+26.9	+0.13
psipred	--EEEEE-----HH--EEEEEEE----EEEEE----EEEE-----EEEEEE--EEEEEE--	+9.6	+24.6	+0.08
sable	--EEEEEE-----EEEEEEEEEE----EEEEEE---EEEEE---EEEEEEE--EEEEE---	+7.7	+20.6	+0.10
samt99_sec	--EEEEEE-----EEEEEEEEEE----EEEEE----EEEE----EEEEEE----EEEE---	+16.6	+29.3	+0.25
scratch	--EEEEEE-----EEEE--EEE-----EEEEE-----EEEEE---EEEEEE--EEEEE---	+8.0	+13.3	0.00

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)