EVA results for 1um3:F

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3...
seq	MTEEMLYAALLSFGLIFVGWGLGVLLLKIQGAE
dssp	--HHHHHHHHHHHHHHHHHHHHHHHHHH-----
apssp2	--HHHHHHHHHHHHHHHHH----EEEEEE----	-5.2	+25.9	-0.01
jufo	--HHHHHHHHHH--EEEEE--HHHHEEEHH---	-11.9	-20.0	-0.04
phd	--HHHHHHHHHHHHHHHHHHHHHHHHHHH----	+25.9	+33.0	+0.49
phdpsi	--HHHHHHHHHHHHHHHHHHHHHHHHHHH----	+24.3	+31.6	+0.47
prof_king	--HHHHHHHHHH--EEEEE--HEEEEEEEE---	-24.2	-31.0	-0.08
profsec	--HHHHHHHHHHH-HHHHHHHHHHHHHH-----	+22.1	+3.2	+0.44
sable	--HHHHHHHHHHHHHHHHHHHHHHHHHHH----	+19.5	+26.7	+0.46
samt99_sec	--HHHHHHHHHHHHHHHHHHHHHHHHHHH----	+22.1	+29.7	+0.44
scratch	-HHHHHHHHHHHHHHHHHHHHHHHHHHHH----	+18.2	+25.6	+0.28

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)