EVA results for 1um3:E

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3..
seq	MILGAVFYIVFIALFFGIAVGIIFAIKSIKLI
dssp	-HHHHHHHHHHHHHHHHHHHHHH---------
apssp2	-EHHHHHHHHHHHHHHHHHHHHHHHHHH----	+6.2	+19.5	+0.02
jufo	----EEEEEEEEEEHHHHHHHHHHHHH-EE--	-28.9	-24.5	-0.19
phd	------HHHHHHHHHHHHHHHHHHHHHHH---	-5.4	+14.8	-0.26
phdpsi	------HHHHHHHHHHHHHHHHHHHHHHH---	-7.0	+13.4	-0.28
profsec	-----HHHHHHHHHHHHHHHHHHHHHHHHHH-	-12.3	-1.1	-0.35
sable	-EEEHHHHHHHHHHHHHHHHHHHHHHHHHHHH	-15	-3.5	-0.18
samt99_sec	---HHHHHHHHHHHHHHHHHEEEEEEEEEEE-	-15.4	+2.6	+0.10
scratch	-HHHHHHHHHHHHHHHHHHHHHHHHHHHH---	+5.5	+13.0	0.00

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)