EVA results for 1kg1:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6
seq	DRCRYTLCCDGALKAVSACLHESESCLVPGDCCRGKSRLTLCSYGEGGNGFQCPTGYRQC
dssp	---EEEEEE------EEEEE------E--EEEEE--EEEEE--E------E------EE-
apssp2	---EEEEE---HHHHHHHHH------E-----------EEEEE--------E--------	-14.9	-13.2	-0.26
jufo	---EEEEE---HHHHHHHHHH------------------EE-------------------	-9.5	-26.1	-0.10
phd	--EE--------E-EEEEEE-----EEE--------EEEEEEE-------EEE----E--	-6.0	-5.8	-0.23
phdpsi	--EE--------E-EEEEEE-----EEE--------EEEEEEE-------EEE----E--	-7.6	-7.2	-0.25
prof_king	---EEEEE----HHHHHHHH------------------EEEEE-----------------	-11.0	-23.4	-0.20
profsec	-EEEE-------EEEEEEEE-----EEE--------EEEEEEE------EEE-----EE-	-9.8	-4.9	-0.28
sable	----EEE---HHHHHHHHHHH-----E-----------EEEEEE----------------	-20.8	-28.7	-0.24
samt99_sec	--EEEEEE---HHHHHHHHH-----------------EEEEE---------E--------	-14.8	-16.3	-0.25
scratch	---EEEE---HHHHHHHHHH-----------------EEEEEE-----------------	-17.3	-29.5	-0.26

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)