EVA results for 1ujl:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4..
seq	AIGNMEQPHMDSRIGWLHNLGDQIGKPYNSSGLGGPSIKDKY
dssp	----------------HHHHHHHH-----------HHHHHH-
apssp2	-----------HH--HHHHHH-HH------------------	+1.1	-11.9	-0.20
jufo	---------------HH----HH-------------------	+1.2	-6.4	-0.17
phd	----------HHHHHHHHHHHHHHHH----------------	-4.3	+3.5	-0.23
phdpsi	----------HHHHHHHHHHHHHHHH----------------	-5.9	+2.1	-0.25
profsec	---------HHHH-HHHHHHHHHH------------------	-3.4	-16.5	-0.25
prospect	--------HHHHHHHHHHHHHHHH------------------	-5.2	-1.8	-0.25
sable	------------HHHHHHHHHHHH-----------------H	-5.4	+7.4	-0.23
samt99_sec	--------HHHHHHHHHHHHHHHH------------------	-8.2	-3.8	-0.28
scratch	----------------HH-HHHH-------------------	+5.4	-2.3	+0.01

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)