EVA results for 1m9o:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4
seq	MTTSSRYKTELCRTYSESGRCRYGAKCQFAHGLGELRQAN
dssp	-------------HHHH------------------HHH--
apssp2	------------HHHHH---------------HHHHH---	+12.4	+25.2	0.00
jufo	--------HHHHHHH-------------------------	+5.0	+12.6	-0.25
phd	--------HHHHHHH-----------E-------------	+1.4	-1.9	-0.27
phdpsi	--------HHHHHHH-----------E-------------	-0.3	-3.6	-0.29
prof_king	------------H---------------------------	+6.8	+9.0	-0.29
profsec	---------HHHHHH------------EE-----------	-2.4	-5.5	-0.30
prospect	------------HHHH------------------------	+15.7	+19.9	-0.06
samt99_sec	------------HHHHH-----------------------	+15.1	+18.1	-0.00
scratch	-------HHHHHHHHHH-----------E---HHH-----	-7.5	-13.3	-0.29

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)