EVA results for 1nqd:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,....6....,...
seq	EKLKEKENNDSSDKATVIPNFNTTMQGSLLGDDSRDYYSFEVKEEGEVNIELDKKDEFGVTWTLHPES
dssp	-EEE-------HHH-EE------EEEEEE-----EEEEEEEE---EEEEEEEEE----EEEEEEEE--
apssp2	--HH-----------E--------EEEEEE-----EEEEEEE------EEEEE------EEEEE----	-0.0	+9.3	-0.01
phd	---------------EEE-----EEEEEE-------EEEEEEE---EEEEEEE-------EEEEEE--	+8.3	+15.9	+0.06
phdpsi	---------------EEE-----EEEEEE-------EEEEEEE---EEEEEEE-------EEEEEE--	+6.3	+14.1	+0.04
prof_king	-EEE----------EEEE------EEEEE------EEEEEEE-----EEEEEEE----EEEEEEE---	+12.0	+23.3	+0.17
profsec	--------------EEEE----EEEEEEEE------EEEEEEE---EEEEEEE------EEEEEEE--	+1.2	+10.2	-0.07
prospect	------------HHHH--------EEEEEE------EEEEEE-----EEEEEE------EEEEEEEHH	+2.8	+12.8	+0.02
scratch	HHHE-------HH----------EEEEE--------EEEEEEE----EEEEE-------EEEEEE---	-0.9	+10.1	-0.02

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)