EVA results for 1n87:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....,....5....,.
seq	MLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPS
dssp	------------EEE-------EEHHHHHHHHHH------------HHH-EE----
apssp2	-EE------------------EEEHHHHHHHHHH------------HHHHHH----	+8.8	-7.7	+0.17
phd	-EEEE--------EEE----EEEHHHHHHHHHHH----------------EEEE--	+3.9	+1.9	+0.13
phdpsi	-EEEE--------EEE----EEEHHHHHHHHHHH----------------EEEE--	+1.9	+0.1	+0.11
prof_king	---------------------EEEHHHHHHHHH-------------HH-HEH----	+12.4	+11.4	+0.15
profsec	-EEEE--------EE-----EEEEHHHHHHHHHH---------------EEE----	+5.1	+2.2	+0.14
prospect	-------------EEE-----EEEHHHHHHHHH-----------------------	+11.7	+9.4	+0.17
scratch	-EEEE--------EE------EEHHHHHHHHHHH------------HHHH------	+4.6	+1.8	+0.15

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)