EVA results for 1cix:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4....
seq	YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY
dssp	--------EEE----------------EEEE-------EEEE--
apssp	----------EEEE-------------E-E--------------	-1.1	-3.6	-0.34
apssp2	----EE-----EHHH------------EEE--------------	-14.9	-12.9	-0.46
phd	----------EEE---------EE---EE-E-------------	+4.4	-10.1	-0.20
phdpsi	--EEEE----------------EE----EEE-------------	-6.3	-20.8	-0.32
profsec	--EEE-----EEE---------------EEEE---------EE-	-6.1	-1.5	-0.32
psipred	----EE----HHHHH-----------------------------	-16.3	-32.9	-0.38
samt99_sec	--HHHHHH--EEEE------------------------------	-18.5	-32.6	-0.29
sspro2	----------EEEE--------------E---------------	-4.5	-2.0	-0.37
jpred	----------EEEE------------------------------	-3.5	-19.8	-0.34
prof_king	--------------------------------------------	+0.2	-41.4	-0.34

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)