EVA results for 1l3y:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4.
seq	ECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQA
dssp	----------------HHHHEEEE--EEEE-----------
apssp	------------EEE-------EEE--EEE-----------	-1.5	-6.1	-0.18
apssp2	-------------EE------EEEE-EEEE-----------	+4.9	-4.6	0.00
jpred	---------------------------EE------------	+1.1	-0.4	-0.07
phd	-------------EE------EEE---EEE-----------	+10.8	+1.8	+0.07
phdpsi	-------------EE------E-----EE------------	-1.3	-11.0	-0.20
prof_king	---------------------EEE--EEE------------	+10.3	+19.8	+0.22
profsec	---------------------EE----EEE-----------	+6.1	+13.6	+0.10
psipred	-------------EE------EEE--EEEE-----------	+5.5	-6.3	+0.03
samt99_sec	------------EE--------EE---EEE-----------	+2.2	-2.7	-0.1
sspro2	-------------E-------EEE--EEEE-----------	+7.8	-2.8	+0.12

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)